Inventors:
Robert Fine - Tenafly NJ, US
Paul Brandt-Rauf - Scarsdale NY, US
Yueha Mao - New York NY, US
International Classification:
A61K 38/16, C07K 14/47, C07H 21/04, C12P 21/06, C12N 15/86
US Classification:
514012000, 530324000, 435069100, 435320100, 435325000, 435456000, 536023200
Abstract:
Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.