PROF. WILLIAM G STETLER-STEVENSON, M.D., PH.D.
Medical Practice in Gaithersburg, MD

License number
Maryland D0035477
Category
Medical Practice
Type
Anatomic Pathology
Address
Address 2
8717 Grovemont Cir Radiation Oncology Br, Gaithersburg, MD 20877
9608 Byeforde Rd, Kensington, MD 20895
Phone
(301) 402-1521
(301) 929-0865

Professional information

William G Stetler-Stevenson Photo 1

Dr. William G Stetler-Stevenson, Gaithersburg MD - MD (Doctor of Medicine)

Specialties:
Anatomic Pathology
Address:
CELL & CANCER BIOLOGY BRANCH, NCI
8717 Grovemont Cir STE 115, Gaithersburg 20877
(301) 402-1521 (Phone)
Certifications:
Anatomic Pathology, 1990
Awards:
Healthgrades Honor Roll
Languages:
English
Education:
Medical School
Northwestern University / Dental School
Northwestern Meml/McGaw Med
Natl Cancer Inst


William Stetler-Stevenson Photo 2

Matrix Metalloproteinase Peptides: Role In Diagnosis And Therapy

US Patent:
5585356, Dec 17, 1996
Filed:
Aug 12, 1994
Appl. No.:
8/289825
Inventors:
Lance A. Liotta - Potomac MD
William G. Stetler-Stevenson - Gaithersburg MD
Henry C. Krutsch - Bethesda MD
International Classification:
A61K 3800
US Classification:
514 17
Abstract:
A family of metalloproteinases exist which cleave extracellular matrix molecules. These metalloproteinases are secreted in a latent inactive form and require activation in order to specifically cleave the preferred substrate. A series of peptides have been prepared based on the complete sequence analysis of type IV procollagenase. Peptide inhibitors were synthesized which correspond to cysteine repeat regions and histidine containing regions; the mechanism of action of these peptides involves inhibition of binding of the enzyme to the substrate. Peptide inhibitors were synthesized which correspond to the peptide cleaved off during activation, and constitute a novel class of metalloproteinase inhibitors. These inhibitors are members of a series of peptides which contain the core amino acid sequence RKPRC or analogs thereof. The cysteine residue is required for activity.


William Stetler-Stevenson Photo 3

Metalloproteinase Peptides: Role In Diagnosis And Therapy

US Patent:
5270447, Dec 14, 1993
Filed:
Mar 1, 1989
Appl. No.:
7/317407
Inventors:
Lance A. Liotta - Potomac MD
William Stetler-Stevenson - Gaithersburg MD
Henry Krutzsch - Bethesda MD
Assignee:
The United States of America as represented by the Department of Health
& Human Services - Washington DC
International Classification:
A61K 3702, C12N 1108
US Classification:
530326
Abstract:
A family of metalloproteinases exist which cleave extracellular matrix molecules. These metalloproteinases are secreted in a latent inactive form and require activation in order to specifically cleave the preferred substrate. A series of peptides have been prepared based on the complete sequence analysis of type IV Procollagenase. Peptide inhibitors were synthesized which correspond to cysteine repeat regions and histidine containing regions; the mechanism of action of these peptides involves inhibition of binding of the enzyme to the substrate. Peptide inhibitors were synthesized which correspond to the peptide cleaved off during activation, and constitute a novel class of metalloproteinase inhibitors. These inhibitors are members of a series of peptides which contain the core amino acid sequence PRCG. The cysteine residue is required for activity.


William Stetler-Stevenson Photo 4

Matrix Metalloproteinase Inhibitor Peptides

US Patent:
5595885, Jan 21, 1997
Filed:
Mar 29, 1993
Appl. No.:
8/039525
Inventors:
William G. Stetler-Stevenson - Gaithersburg MD
Lance A. Liotta - Potomac MD
Henry C. Krutzsch - Bethesda MD
Assignee:
The United States of America as represented by the Department of Health
and Human Services - Washington DC
International Classification:
C12N 1500
US Classification:
435 692
Abstract:
The present invention is an isolated protein of 21,600 Da which binds to both latent and activated type IV collagenase with high affinity at 1:1 molar stoichiometry, thereby abolishing enzyme activity. The protein is purified by affinity chromatography on solid phase metalloproteinase, or solid phase metalloproteinase substrates which bind the enzyme-inhibitor complex. The complete primary structure of this protein (initially called CSC-21K), as determined by sequencing overlapping peptides spanning the entire protein, reveals homology with a protein called TIMP, Tissue Inhibitor of Metalloproteinases. In addition, a cDNA for this novel inhibitor, now designated TIMP-2, was cloned from a melanoma cell and its sequence was compared with that of human TIMP-1. Northern blots of melanoma cell mRNA showed two distinct transcripts of 0. 9 kb and 3.


William Stetler-Stevenson Photo 5

Metalloproteinase Peptides

US Patent:
5698671, Dec 16, 1997
Filed:
Aug 2, 1994
Appl. No.:
8/284721
Inventors:
William G. Stetler-Stevenson - Gaithersburg MD
Lance A. Liotta - Potomac MD
Henry C. Krutzsch - Bethesda MD
Assignee:
The United States of America as represented by the Secretary of the
Department of Health and Human Services - Washington DC
International Classification:
C07K 700
US Classification:
530324
Abstract:
Inappropriate degradation of extracellular matrix molecules by metalloproteinases plays an important role in a wide variety of pathologic conditions including neoplasia and arthritis. The present invention is an isolated protein of approximately 23,000 daltons in size which binds to metalloproteinases with high affinity, can be purified using affinity chromatography on solid phase metalloproteinases, and is potentially useful for therapy of pathologic conditions involving the inappropriate production of metalloproteinases. This protein is characterized by the presence of the following amino acid sequences: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNPIYGNNI KDIEFIYTAPSEAVCGVELDVEGK KRHITLCDFIVPWDTLSTTQKKSLNHRYQQGCEECKITRCPMIPCYISSPDECLWTDTVV KFFACIKRHITLCDFIVPWSQIADXLSS With the positions of the cysteine residues and associated disulfide bridges required for biologic activity.


William Stetler-Stevenson Photo 6

Method For Measuring Type Iv Collagenase

US Patent:
5869277, Feb 9, 1999
Filed:
Nov 8, 1991
Appl. No.:
7/789652
Inventors:
William G. Stetler-Stevenson - Gaithersburg MD
Lance Liotta - Potomac MD
International Classification:
C12Q 128, C12Q 137, G01N 3353
US Classification:
435 28
Abstract:
The present invention relates to the development of a modified substrate capture immunoassay useful in the detection of a neutral metalloproteinase enzyme, type IV collagenase. Capture and immobilization of this enzyme can be achieved by coating the microtiter plate with gelatin, an alternative substrate for this enzyme. The captured enzyme can then be detected by affinity purified rabbit anti-type IV collagenase antibodies prepared against synthetic peptides from the amino terminus of the enzyme. Soluble type IV collagenase can readily be detected in samples known to contain this enzyme. Using purified enzyme this assay method can detect less than 50 ng of latent type IV collagenase. Using EDTA, an inhibitor of this metalloproteinase, gelatin binding can be shown to be independent of catalytic activity.


William Stetler-Stevenson Photo 7

Compositions And Methods For Promoting Angiogenesis

US Patent:
7462593, Dec 9, 2008
Filed:
Nov 7, 2003
Appl. No.:
10/529116
Inventors:
Frank Cuttitta - Adamstown MD, US
Alfredo Martinez - 26144 Galilea, La Rioja, ES
William G. Stetler-Stevenson - Kensington MD, US
International Classification:
A61K 38/00
US Classification:
514 2, 514 13
Abstract:
The present disclosure concerns the use of peptides and compositions, such as pharmaceutical compositions, to influence angiogenesis. Particular methods are useful for promoting angiogenesis, while others are particularly useful for inhibiting angiogenesis.


William Stetler-Stevenson Photo 8

Methods For Inhibiting Angiogenesis With Inhibitors Of Proadrenomedullin N-Terminal 20 Peptide (Pamp)

US Patent:
7862815, Jan 4, 2011
Filed:
Sep 29, 2008
Appl. No.:
12/240656
Inventors:
Frank Cuttitta - Adamstown MD, US
Alfredo Martinez - La Rioja, ES
William G. Stetler-Stevenson - Kensington MD, US
Assignee:
The United States of America as represented by the Department of Health and Human Services - Washington DC
International Classification:
A61K 39/395, A61K 38/08, C07K 4/12, C07K 7/06, C07K 16/18
US Classification:
4241391, 514 15, 530328, 5303879
Abstract:
The present disclosure concerns the use of peptides and compositions, such as pharmaceutical compositions, to influence angiogenesis. Particular methods are useful for promoting angiogenesis, while others are particularly useful for inhibiting angiogenesis.


William Stetler-Stevenson Photo 9

Vasoregulating Compounds And Methods Of Their Use

US Patent:
7364719, Apr 29, 2008
Filed:
Oct 3, 2003
Appl. No.:
10/529118
Inventors:
Frank Cuttitta - Adamstown MD, US
Alfredo Martinez - Bethesda MD, US
William G. Stetler-Stevenson - Kensington MD, US
Edward J. Unsworth - Kensington MD, US
Juan M. Saavedra - Bethesda MD, US
Assignee:
The United States of America as represented by the Department of Health and Human Services - Washington DC
International Classification:
A61K 49/00
US Classification:
424 91, 424 111, 424 165, 424 169, 424 92
Abstract:
Methods and compounds are described for regulating blood pressure in a subject. Specific embodiments are methods for reversing vasodilation of blood vessels, by administering to a subject a therapeutically effective amount peptide AM(11-22). The vasoconstrictor can be used for a variety of purposes, including hemostasis or the treatment of shock, for example vasodilatory shock syndromes such as septic shock. Other specific embodiments are methods for reversing vasoconstriction of blood vessels, by administering to a subject a therapeutically effect amount of an inhibitor of AM(11-22), sufficient to reduce hypertension in the subject. Compounds and pharmaceutical compositions are also provided, as are kits.