Inventors:
Tur-Fu Huang - Taipei, TW
Stefan Niewiarowski - Narberth PA
John C. Holt - Philadelphia PA
Hanna Lukasiewicz - Warsaw, PL
Assignee:
Temple University of the Commonwealth System of Higher Education - Philadelphia PA
International Classification:
C12N 508, A61K 3702, C07K 710, C07K 1508
Abstract:
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.